CSF3 (Human) Recombinant Protein, Mammal

Catalog Number: ABN-P8705
Article Name: CSF3 (Human) Recombinant Protein, Mammal
Biozol Catalog Number: ABN-P8705
Supplier Catalog Number: P8705
Alternative Catalog Number: ABN-P8705-2
Manufacturer: Abnova
Host: Mammal
Category: Proteine/Peptide
Application: FA
Species Reactivity: Human
Human CSF3 recombinant protein expressed in CHO cells.
UniProt: 1440
Buffer: Protein (1 mg/mL) was lyophilized from a solution containing 10 mM Hydrochloric Acid, pH=6.5, 0.4 mg TWEEN-20, 100 mg mannitol, 160 mg L-arginine, 40 mg phenylalanine and 4 mg methionine. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL
Form: Lyophilized
Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Target: CSF3