TMEM61 polyclonal antibody

Artikelnummer: ABN-PAB22469
Artikelname: TMEM61 polyclonal antibody
Artikelnummer: ABN-PAB22469
Hersteller Artikelnummer: PAB22469
Alternativnummer: ABN-PAB22469-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human TMEM61.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant TMEM61.
UniProt: 199964
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: PRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARG
Target-Kategorie: TMEM61
Application Verdünnung: Immunohistochemistry (1:200-1:500)The optimal working dilution should be determined by the end user.