TMEM61 polyclonal antibody

Catalog Number: ABN-PAB22469
Article Name: TMEM61 polyclonal antibody
Biozol Catalog Number: ABN-PAB22469
Supplier Catalog Number: PAB22469
Alternative Catalog Number: ABN-PAB22469-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human TMEM61.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant TMEM61.
UniProt: 199964
Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: PRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARG
Target: TMEM61
Application Dilute: Immunohistochemistry (1:200-1:500)The optimal working dilution should be determined by the end user.