TMEM61 polyclonal antibody
Catalog Number:
ABN-PAB22469
| Article Name: |
TMEM61 polyclonal antibody |
| Biozol Catalog Number: |
ABN-PAB22469 |
| Supplier Catalog Number: |
PAB22469 |
| Alternative Catalog Number: |
ABN-PAB22469-100 |
| Manufacturer: |
Abnova |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein corresponding to amino acids of human TMEM61. |
| Alternative Names: |
ABN-202409-10_Ab |
| Rabbit polyclonal antibody raised against recombinant TMEM61. |
| UniProt: |
199964 |
| Buffer: |
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Form: |
Liquid |
| Sequence: |
PRWDPYHLSRDLYYLTVESSEKESCRTPKVVDIPTYEEAVSFPVAEGPPTPPAYPTEEALEPSGSRDALLSTQPAWPPPSYESISLALDAVSAETTPSATRSCSGLVQTARG |
| Target: |
TMEM61 |
| Application Dilute: |
Immunohistochemistry (1:200-1:500)The optimal working dilution should be determined by the end user. |
