ACE2 polyclonal antibody, Rabbit

Artikelnummer: ABN-PAB30253
Artikelname: ACE2 polyclonal antibody, Rabbit
Artikelnummer: ABN-PAB30253
Hersteller Artikelnummer: PAB30253
Alternativnummer: ABN-PAB30253-100
Hersteller: Abnova
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to amino acids of human ACE2.
Alternative Synonym: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant human ACE2.
UniProt: 59272
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Formulierung: Liquid
Sequenz: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
Target-Kategorie: ACE2
Application Verdünnung: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)Western Blot (1:100-1:250)The optimal working dilution should be determined by the end user.