ACE2 polyclonal antibody, Rabbit

Product Overview

• Article Name: ACE2 polyclonal antibody, Rabbit
• Biozol Catalog Number: ABN-PAB30253
• Supplier Catalog Number: PAB30253
• Alternative Catalog Number: ABN-PAB30253-100
• Manufacturer: Abnova
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein corresponding to amino acids of human ACE2.
• Alternative Names: ABN-202409-10_Ab

Product Description

Rabbit polyclonal antibody raised against recombinant human ACE2.

Product Properties

• UniProt: 59272
• Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Form: Liquid
• Sequence: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
• Target: ACE2

Application Notes

• Application Dilute: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)Western Blot (1:100-1:250)The optimal working dilution should be determined by the end user.