Firefly Luciferase mRNA (N1-Me-Pseudo UTP)
Artikelnummer:
ABN-U0862
- Bilder (0)
| Artikelname: | Firefly Luciferase mRNA (N1-Me-Pseudo UTP) |
| Artikelnummer: | ABN-U0862 |
| Hersteller Artikelnummer: | U0862 |
| Alternativnummer: | ABN-U0862-100 |
| Hersteller: | Abnova |
| Kategorie: | Molekularbiologie |
| Firefly Luciferase mRNA (N1-Me-Pseudo UTP) is synthesized using T7 High Yield RNA Transcription Kit (Cat KA7469) and modified with Cap 1 Capping System (Cat U0857) to achieve a mature mRNA structure with a 5 Cap 1 structure and a 3 poly(A) tail. The sequence of firefly Luciferase mRNA originates from Photinus pyralis. Firefly luciferase is widely used as a bioluminescent reporter gene, serving as a control in studies involving target gene translation efficiency, cell viability, and in vivo imaging in mammalian cells. |
| Konzentration: | 1 mg/mL |
| Formulierung: | Liquid |
| Sequenz: | MEDAKNIKKGPAPRYPLEDGTAGEQLHKAMKRYAQVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSEN SLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSH LPPGFNEYDFKPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIKPDTAILSVVPFHHGFGMFTTL |
| Application Verdünnung: | The optimal working dilution should be determined by the end user. |
