Firefly Luciferase mRNA (N1-Me-Pseudo UTP)

Artikelnummer: ABN-U0862
Artikelname: Firefly Luciferase mRNA (N1-Me-Pseudo UTP)
Artikelnummer: ABN-U0862
Hersteller Artikelnummer: U0862
Alternativnummer: ABN-U0862-100
Hersteller: Abnova
Kategorie: Molekularbiologie
Firefly Luciferase mRNA (N1-Me-Pseudo UTP) is synthesized using T7 High Yield RNA Transcription Kit (Cat KA7469) and modified with Cap 1 Capping System (Cat U0857) to achieve a mature mRNA structure with a 5 Cap 1 structure and a 3 poly(A) tail. The sequence of firefly Luciferase mRNA originates from Photinus pyralis. Firefly luciferase is widely used as a bioluminescent reporter gene, serving as a control in studies involving target gene translation efficiency, cell viability, and in vivo imaging in mammalian cells.
Konzentration: 1 mg/mL
Formulierung: Liquid
Sequenz: MEDAKNIKKGPAPRYPLEDGTAGEQLHKAMKRYAQVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSEN SLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSH LPPGFNEYDFKPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIKPDTAILSVVPFHHGFGMFTTL
Application Verdünnung: The optimal working dilution should be determined by the end user.