Firefly Luciferase mRNA (N1-Me-Pseudo UTP)

Catalog Number: ABN-U0862
Article Name: Firefly Luciferase mRNA (N1-Me-Pseudo UTP)
Biozol Catalog Number: ABN-U0862
Supplier Catalog Number: U0862
Alternative Catalog Number: ABN-U0862-100
Manufacturer: Abnova
Category: Molekularbiologie
Firefly Luciferase mRNA (N1-Me-Pseudo UTP) is synthesized using T7 High Yield RNA Transcription Kit (Cat KA7469) and modified with Cap 1 Capping System (Cat U0857) to achieve a mature mRNA structure with a 5 Cap 1 structure and a 3 poly(A) tail. The sequence of firefly Luciferase mRNA originates from Photinus pyralis. Firefly luciferase is widely used as a bioluminescent reporter gene, serving as a control in studies involving target gene translation efficiency, cell viability, and in vivo imaging in mammalian cells.
Concentration: 1 mg/mL
Form: Liquid
Sequence: MEDAKNIKKGPAPRYPLEDGTAGEQLHKAMKRYAQVPGTIAFTDAHIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSEN SLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSH LPPGFNEYDFKPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIKPDTAILSVVPFHHGFGMFTTL
Application Dilute: The optimal working dilution should be determined by the end user.