Cre mRNA (N1-Me-Pseudo UTP)

Artikelnummer: ABN-U0870
Artikelname: Cre mRNA (N1-Me-Pseudo UTP)
Artikelnummer: ABN-U0870
Hersteller Artikelnummer: U0870
Alternativnummer: ABN-U0870-100
Hersteller: Abnova
Kategorie: Molekularbiologie
Cre (Cyclization Recombination Enzyme) is a 38 kDa DNA recombinase isolated from the P1 bacteriophage. Cre specifically recognizes loxP DNA sequences and mediates site-specific deletion of DNA sequences located between two loxP sites. The Cre-loxP system is primarilyused for gene knockout and can also induce inversion or translocation of DNA sequences depending on the position and orientation of the loxP sites.
Konzentration: 1 mg/mL
Tag: Flag (N-term)
Formulierung: Liquid
Sequenz: MDYKDDDDKKKRKVSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPA EPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSL MENSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDP NNYLF
Application Verdünnung: The optimal working dilution should be determined by the end user.