Cre mRNA (N1-Me-Pseudo UTP)

Catalog Number: ABN-U0870
Article Name: Cre mRNA (N1-Me-Pseudo UTP)
Biozol Catalog Number: ABN-U0870
Supplier Catalog Number: U0870
Alternative Catalog Number: ABN-U0870-100
Manufacturer: Abnova
Category: Molekularbiologie
Cre (Cyclization Recombination Enzyme) is a 38 kDa DNA recombinase isolated from the P1 bacteriophage. Cre specifically recognizes loxP DNA sequences and mediates site-specific deletion of DNA sequences located between two loxP sites. The Cre-loxP system is primarilyused for gene knockout and can also induce inversion or translocation of DNA sequences depending on the position and orientation of the loxP sites.
Concentration: 1 mg/mL
Tag: Flag (N-term)
Form: Liquid
Sequence: MDYKDDDDKKKRKVSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPA EPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSL MENSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDP NNYLF
Application Dilute: The optimal working dilution should be determined by the end user.