eGFP saRNA (5-Methyl-CTP)

Artikelnummer: ABN-U0875
Artikelname: eGFP saRNA (5-Methyl-CTP)
Artikelnummer: ABN-U0875
Hersteller Artikelnummer: U0875
Alternativnummer: ABN-U0875-100
Hersteller: Abnova
Kategorie: Molekularbiologie
eGFP saRNA is a synthetic self-amplifying RNA produced in vitro. Its replicase module, derived from Venezuelan equine encephalitis virus (VEEV), enables sustained gene amplification in mammalian systems, facilitating low-dose, high-level, and long-lasting target gene expression. It encodes an enhanced green fluorescent protein, it can express stable green fluorescence.
Konzentration: 1 mg/mL
Puffer: 1 mM sodium citrate buffer
Formulierung: Liquid
Sequenz: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHD FFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNF KIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Application Verdünnung: The optimal working dilution should be determined by the end user.