eGFP saRNA (5-Methyl-CTP)

Catalog Number: ABN-U0875
Article Name: eGFP saRNA (5-Methyl-CTP)
Biozol Catalog Number: ABN-U0875
Supplier Catalog Number: U0875
Alternative Catalog Number: ABN-U0875-100
Manufacturer: Abnova
Category: Molekularbiologie
eGFP saRNA is a synthetic self-amplifying RNA produced in vitro. Its replicase module, derived from Venezuelan equine encephalitis virus (VEEV), enables sustained gene amplification in mammalian systems, facilitating low-dose, high-level, and long-lasting target gene expression. It encodes an enhanced green fluorescent protein, it can express stable green fluorescence.
Concentration: 1 mg/mL
Buffer: 1 mM sodium citrate buffer
Form: Liquid
Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHD FFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNF KIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Application Dilute: The optimal working dilution should be determined by the end user.