Anti-Cytochrome P450 2D6 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer:
ABT-ABO10084
| Artikelname: |
Anti-Cytochrome P450 2D6 Picoband Antibody, Rabbit, Polyclonal |
| Artikelnummer: |
ABT-ABO10084 |
| Hersteller Artikelnummer: |
ABO10084 |
| Alternativnummer: |
ABT-ABO10084-100UG |
| Hersteller: |
Abcepta |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC-P, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM). |
| Alternative Synonym: |
Cytochrome P450 2D6, 1.14.14.1, CYPIID6, Cholesterol 25-hydroxylase, Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, CYP2D6, CYP2DL1 |
| Rabbit IgG polyclonal antibody for Cytochrome P450 2D6(CYP2D6) detection. Tested with WB, IHC-P in Human,Mouse,Rat. |
| Klonalität: |
Polyclonal |
| Konzentration: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Molekulargewicht: |
55769 |
| NCBI: |
1565 |
| UniProt: |
P10635 |
| Formulierung: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Anwendungsbeschreibung: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
