Anti-Cytochrome P450 2D6 Picoband Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-Cytochrome P450 2D6 Picoband Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: ABT-ABO10084
• Supplier Catalog Number: ABO10084
• Alternative Catalog Number: ABT-ABO10084-100UG
• Manufacturer: Abcepta
• Host: Rabbit
• Category: Antikörper
• Application: WB, IHC-P
• Species Reactivity: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).
• Alternative Names: Cytochrome P450 2D6, 1.14.14.1, CYPIID6, Cholesterol 25-hydroxylase, Cytochrome P450-DB1, Debrisoquine 4-hydroxylase, CYP2D6, CYP2DL1

Product Description

Rabbit IgG polyclonal antibody for Cytochrome P450 2D6(CYP2D6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Product Properties

• Clonality: Polyclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molecular Weight: 55769
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Images