Anti-Nectin-4/PVRL4 Picoband Antibody, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-Nectin-4/PVRL4 Picoband Antibody, Rabbit, Polyclonal
• Artikelnummer: ABT-ABO11709
• Hersteller Artikelnummer: ABO11709
• Alternativnummer: ABT-ABO11709-100UG
• Hersteller: Abcepta
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
• Alternative Synonym: Nectin-4, Ig superfamily receptor LNIR, Nectin cell adhesion molecule 4 {ECO:0000312|HGNC:HGNC:19688}, Poliovirus receptor-related protein 4, Processed poliovirus receptor-related protein 4, NECTIN4 (HGNC:19688)

Produktbeschreibung

Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Tested with WB in Human.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molekulargewicht: 55454
• NCBI: 81607
• UniProt: Q96NY8
• Formulierung: Lyophilized
• Antibody Type: Polyclonal Antibody

Anwendungsbeschreibung

• Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Bilder