Anti-Nectin-4/PVRL4 Picoband Antibody, Rabbit, Polyclonal

Catalog Number: ABT-ABO11709
Article Name: Anti-Nectin-4/PVRL4 Picoband Antibody, Rabbit, Polyclonal
Biozol Catalog Number: ABT-ABO11709
Supplier Catalog Number: ABO11709
Alternative Catalog Number: ABT-ABO11709-100UG
Manufacturer: Abcepta
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
Alternative Names: Nectin-4, Ig superfamily receptor LNIR, Nectin cell adhesion molecule 4 {ECO:0000312|HGNC:HGNC:19688}, Poliovirus receptor-related protein 4, Processed poliovirus receptor-related protein 4, NECTIN4 (HGNC:19688)
Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Tested with WB in Human.
Clonality: Polyclonal
Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight: 55454
NCBI: 81607
UniProt: Q96NY8
Form: Lyophilized
Antibody Type: Polyclonal Antibody
Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.