Anti-RbAp48 Picoband Antibody, Rabbit, Polyclonal

Artikelnummer: ABT-ABO12483
Artikelname: Anti-RbAp48 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer: ABT-ABO12483
Hersteller Artikelnummer: ABO12483
Alternativnummer: ABT-ABO12483-100UG
Hersteller: Abcepta
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-Fr, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
Alternative Synonym: Histone-binding protein RBBP4, Chromatin assembly factor 1 subunit C, CAF-1 subunit C, Chromatin assembly factor I p48 subunit, CAF-I 48 kDa subunit, CAF-I p48, Nucleosome-remodeling factor subunit RBAP48, Retinoblastoma-binding protein 4, RBBP-4, Retinoblastoma-binding protein p48, RBBP4, RBAP48
Rabbit IgG polyclonal antibody for Histone-binding protein RBBP4(RBBP4) detection. Tested with WB, IHC-P, IHC-F in Human,Mouse,Rat.
Klonalität: Polyclonal
Konzentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molekulargewicht: 47656
NCBI: 5928
UniProt: Q09028
Formulierung: Lyophilized
Antibody Type: Polyclonal Antibody
Anwendungsbeschreibung: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.