Anti-RbAp48 Picoband Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RbAp48 Picoband Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: ABT-ABO12483
• Supplier Catalog Number: ABO12483
• Alternative Catalog Number: ABT-ABO12483-100UG
• Manufacturer: Abcepta
• Host: Rabbit
• Category: Antikörper
• Application: IHC-Fr, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
• Alternative Names: Histone-binding protein RBBP4, Chromatin assembly factor 1 subunit C, CAF-1 subunit C, Chromatin assembly factor I p48 subunit, CAF-I 48 kDa subunit, CAF-I p48, Nucleosome-remodeling factor subunit RBAP48, Retinoblastoma-binding protein 4, RBBP-4, Retinoblastoma-binding protein p48, RBBP4, RBAP48

Product Description

Rabbit IgG polyclonal antibody for Histone-binding protein RBBP4(RBBP4) detection. Tested with WB, IHC-P, IHC-F in Human,Mouse,Rat.

Product Properties

• Clonality: Polyclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molecular Weight: 47656
• NCBI: 5928
• UniProt: Q09028
• Form: Lyophilized
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Images