Anti-BAF53b Antibody FL650 Conjugate, IgG1, Clone: [N332B/15], Mouse, Monoclonal

Artikelnummer: ANI-75-311-FL650
Artikelname: Anti-BAF53b Antibody FL650 Conjugate, IgG1, Clone: [N332B/15], Mouse, Monoclonal
Artikelnummer: ANI-75-311-FL650
Hersteller Artikelnummer: 75-311-FL650
Alternativnummer: ANI-75-311-FL650
Hersteller: Antibodies Incorporated
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse
Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
Konjugation: FL650
Alternative Synonym: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)
Our Anti-BAF53b mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Klonalität: Monoclonal
Konzentration: 0.5 mg/mL
Klon-Bezeichnung: [N332B/15]
Molekulargewicht: 53 kDa
Isotyp: IgG1
UniProt: O94805
Puffer: PBS with 0.09% azide
Reinheit: Purified by Protein A chromatography
Formulierung: Purified by Protein A chromatography
Target-Kategorie: BAF53b
Antibody Type: Primary Antibody