Anti-BAF53b Antibody FL650 Conjugate, IgG1, Clone: [N332B/15], Mouse, Monoclonal

Product Overview

• Article Name: Anti-BAF53b Antibody FL650 Conjugate, IgG1, Clone: [N332B/15], Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-311-FL650
• Supplier Catalog Number: 75-311-FL650
• Alternative Catalog Number: ANI-75-311-FL650
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human, Mouse
• Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
• Conjugation: FL650
• Alternative Names: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)

Product Description

Our Anti-BAF53b mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by Protein A chromatography. It is great for use in IHC, ICC.

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5 mg/mL
• Clone Designation: [N332B/15]
• Molecular Weight: 53 kDa
• Isotype: IgG1
• UniProt: O94805
• Buffer: PBS with 0.09% azide
• Purity: Purified by Protein A chromatography
• Form: Purified by Protein A chromatography
• Target: BAF53b
• Antibody Type: Primary Antibody