Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
Conjugation:
FL650
Alternative Names:
Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)
Our Anti-BAF53b mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by Protein A chromatography. It is great for use in IHC, ICC.