Anti-REEP1 Antibody (BSA and Azide free), IgG2b, Clone: [N345/51], Unconjugated, Mouse, Monoclonal

Produktübersicht

• Artikelname: Anti-REEP1 Antibody (BSA and Azide free), IgG2b, Clone: [N345/51], Unconjugated, Mouse, Monoclonal
• Artikelnummer: ANI-75-313-CF
• Hersteller Artikelnummer: 75-313-CF
• Alternativnummer: ANI-75-313-CF
• Hersteller: Antibodies Incorporated
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA, ICC, IHC, WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
• Konjugation: Unconjugated
• Alternative Synonym: Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)

Produktbeschreibung

Our carrier-free Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: 1 mg/mL
• Klon-Bezeichnung: [N345/51]
• Molekulargewicht: 22 kDa
• Isotyp: IgG2b
• UniProt: Q8BGH4
• Puffer: PBS
• Target-Kategorie: REEP1
• Antibody Type: Primary Antibody