Anti-REEP1 Antibody (BSA and Azide free), IgG2b, Clone: [N345/51], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-REEP1 Antibody (BSA and Azide free), IgG2b, Clone: [N345/51], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-313-CF
• Supplier Catalog Number: 75-313-CF
• Alternative Catalog Number: ANI-75-313-CF
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ELISA, ICC, IHC, WB
• Species Reactivity: Mouse, Rat
• Immunogen: Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
• Conjugation: Unconjugated
• Alternative Names: Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)

Product Description

Our carrier-free Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.

Product Properties

• Clonality: Monoclonal
• Concentration: 1 mg/mL
• Clone Designation: [N345/51]
• Molecular Weight: 22 kDa
• Isotype: IgG2b
• UniProt: Q8BGH4
• Buffer: PBS
• Target: REEP1
• Antibody Type: Primary Antibody