Anti-SPCS2

Catalog Number: ATA-HPA017351
Article Name: Anti-SPCS2
Biozol Catalog Number: ATA-HPA017351
Supplier Catalog Number: HPA017351
Alternative Catalog Number: ATA-HPA017351-100,ATA-HPA017351-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0102
Clonality: Polyclonal
Concentration: 0,05
NCBI: 9789
UniProt: Q15005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKL
Target: SPCS2
HPA017351-100ul