RBL1 Antibody : HRP (ARP31025_P050-HRP), Rabbit, Polyclonal

Produktübersicht

• Artikelname: RBL1 Antibody : HRP (ARP31025_P050-HRP), Rabbit, Polyclonal
• Artikelnummer: ASB-ARP31025_P050-HRP
• Hersteller Artikelnummer: ARP31025_P050-HRP
• Alternativnummer: ASB-ARP31025_P050-HRP-100UL
• Hersteller: Aviva
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH
• Konjugation: HRP
• Alternative Synonym: PRB1, p107, CP107

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 121 kDa
• NCBI: 5933
• UniProt: P28749
• Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.