RBL1 Antibody : HRP (ARP31025_P050-HRP), Rabbit, Polyclonal

Catalog Number: ASB-ARP31025_P050-HRP
Article Name: RBL1 Antibody : HRP (ARP31025_P050-HRP), Rabbit, Polyclonal
Biozol Catalog Number: ASB-ARP31025_P050-HRP
Supplier Catalog Number: ARP31025_P050-HRP
Alternative Catalog Number: ASB-ARP31025_P050-HRP-100UL
Manufacturer: Aviva
Host: Rabbit
Category: Antikörper
Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence NMIRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH
Conjugation: HRP
Alternative Names: PRB1, p107, CP107
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 121 kDa
NCBI: 5933
UniProt: P28749
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.