CUX1 Antibody : HRP (ARP40035_P050-HRP), Rabbit, Polyclonal

Produktübersicht

• Artikelname: CUX1 Antibody : HRP (ARP40035_P050-HRP), Rabbit, Polyclonal
• Artikelnummer: ASB-ARP40035_P050-HRP
• Hersteller Artikelnummer: ARP40035_P050-HRP
• Alternativnummer: ASB-ARP40035_P050-HRP-100UL
• Hersteller: Aviva
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Bovine, Canine, Human, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF
• Konjugation: HRP
• Alternative Synonym: CDP, CUX, p75, CASP, CDP1, COY1, Clox, GDDI, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 164 kDa
• NCBI: 1523
• UniProt: P39880
• Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.