CUX1 Antibody : HRP (ARP40035_P050-HRP), Rabbit, Polyclonal
Catalog Number:
ASB-ARP40035_P050-HRP
- Images (0)
| Article Name: | CUX1 Antibody : HRP (ARP40035_P050-HRP), Rabbit, Polyclonal |
| Biozol Catalog Number: | ASB-ARP40035_P050-HRP |
| Supplier Catalog Number: | ARP40035_P050-HRP |
| Alternative Catalog Number: | ASB-ARP40035_P050-HRP-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Antikörper |
| Species Reactivity: | Bovine, Canine, Human, Porcine |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence LQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF |
| Conjugation: | HRP |
| Alternative Names: | CDP, CUX, p75, CASP, CDP1, COY1, Clox, GDDI, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317 |
