RHCG Antibody : Biotin (ARP42465_P050-Biotin), Rabbit, Polyclonal
Artikelnummer:
ASB-ARP42465_P050-BIOTIN
- Bilder (0)
| Artikelname: | RHCG Antibody : Biotin (ARP42465_P050-Biotin), Rabbit, Polyclonal |
| Artikelnummer: | ASB-ARP42465_P050-BIOTIN |
| Hersteller Artikelnummer: | ARP42465_P050-Biotin |
| Alternativnummer: | ASB-ARP42465_P050-BIOTIN-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC |
| Konjugation: | Biotin |
| Alternative Synonym: | RHGK, PDRC2, C15orf6, SLC42A3 |
