RHCG Antibody : Biotin (ARP42465_P050-Biotin), Rabbit, Polyclonal

Product Overview

• Article Name: RHCG Antibody : Biotin (ARP42465_P050-Biotin), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP42465_P050-BIOTIN
• Supplier Catalog Number: ARP42465_P050-Biotin
• Alternative Catalog Number: ASB-ARP42465_P050-BIOTIN-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC
• Conjugation: Biotin
• Alternative Names: RHGK, PDRC2, C15orf6, SLC42A3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 53 kDa
• NCBI: 51458
• UniProt: Q9UBD6
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.