NOX3 Antibody : FITC (ARP47185_P050-FITC), Rabbit, Polyclonal

Artikelnummer: ASB-ARP47185_P050-FITC
Artikelname: NOX3 Antibody : FITC (ARP47185_P050-FITC), Rabbit, Polyclonal
Artikelnummer: ASB-ARP47185_P050-FITC
Hersteller Artikelnummer: ARP47185_P050-FITC
Alternativnummer: ASB-ARP47185_P050-FITC-100UL
Hersteller: Aviva
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF
Konjugation: FITC
Alternative Synonym: MOX-2, GP91-3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 65 kDa
NCBI: 50508
UniProt: Q9HBY0
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.