NOX3 Antibody : FITC (ARP47185_P050-FITC), Rabbit, Polyclonal

Product Overview

• Article Name: NOX3 Antibody : FITC (ARP47185_P050-FITC), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP47185_P050-FITC
• Supplier Catalog Number: ARP47185_P050-FITC
• Alternative Catalog Number: ASB-ARP47185_P050-FITC-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF
• Conjugation: FITC
• Alternative Names: MOX-2, GP91-3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 65 kDa
• NCBI: 50508
• UniProt: Q9HBY0
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.