MBTPS2 Antibody : HRP (ARP47191_P050-HRP), Rabbit, Polyclonal

Artikelnummer: ASB-ARP47191_P050-HRP
Artikelname: MBTPS2 Antibody : HRP (ARP47191_P050-HRP), Rabbit, Polyclonal
Artikelnummer: ASB-ARP47191_P050-HRP
Hersteller Artikelnummer: ARP47191_P050-HRP
Alternativnummer: ASB-ARP47191_P050-HRP-100UL
Hersteller: Aviva
Wirt: Rabbit
Kategorie: Antikörper
Spezies Reaktivität: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LVVVVVGGWTVVYLTDLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTA
Konjugation: HRP
Alternative Synonym: S2P, IFAP, KFSD, OI19, KFSDX, OLMSX, BRESEK
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 57 kDa
NCBI: 51360
UniProt: O43462
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.