MBTPS2 Antibody : HRP (ARP47191_P050-HRP), Rabbit, Polyclonal

Product Overview

• Article Name: MBTPS2 Antibody : HRP (ARP47191_P050-HRP), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP47191_P050-HRP
• Supplier Catalog Number: ARP47191_P050-HRP
• Alternative Catalog Number: ASB-ARP47191_P050-HRP-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LVVVVVGGWTVVYLTDLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTA
• Conjugation: HRP
• Alternative Names: S2P, IFAP, KFSD, OI19, KFSDX, OLMSX, BRESEK

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 57 kDa
• NCBI: 51360
• UniProt: O43462
• Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.