GBA2 Antibody : FITC (ARP57499_P050-FITC), Rabbit, Polyclonal

Produktübersicht

• Artikelname: GBA2 Antibody : FITC (ARP57499_P050-FITC), Rabbit, Polyclonal
• Artikelnummer: ASB-ARP57499_P050-FITC
• Hersteller Artikelnummer: ARP57499_P050-FITC
• Alternativnummer: ASB-ARP57499_P050-FITC-100UL
• Hersteller: Aviva
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ
• Konjugation: FITC
• Alternative Synonym: AD035, SPG46, NLGase

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 105 kDa
• NCBI: 57704
• UniProt: Q9HCG7
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.