GBA2 Antibody : FITC (ARP57499_P050-FITC), Rabbit, Polyclonal
Catalog Number:
ASB-ARP57499_P050-FITC
- Images (0)
| Article Name: | GBA2 Antibody : FITC (ARP57499_P050-FITC), Rabbit, Polyclonal |
| Biozol Catalog Number: | ASB-ARP57499_P050-FITC |
| Supplier Catalog Number: | ARP57499_P050-FITC |
| Alternative Catalog Number: | ASB-ARP57499_P050-FITC-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Antikörper |
| Species Reactivity: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence MCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQ |
| Conjugation: | FITC |
| Alternative Names: | AD035, SPG46, NLGase |
