FMN1 Antibody : Biotin (ARP61897_P050-Biotin), Rabbit, Polyclonal

Produktübersicht

• Artikelname: FMN1 Antibody : Biotin (ARP61897_P050-Biotin), Rabbit, Polyclonal
• Artikelnummer: ASB-ARP61897_P050-BIOTIN
• Hersteller Artikelnummer: ARP61897_P050-Biotin
• Alternativnummer: ASB-ARP61897_P050-BIOTIN-100UL
• Hersteller: Aviva
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC
• Spezies Reaktivität: Canine, Equine, Guinea pig, Human, Mouse, Rabbit
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSF
• Konjugation: Biotin
• Alternative Synonym: LD, FMN

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 158 kDa
• NCBI: 342184
• UniProt: Q68DA7
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.