FMN1 Antibody : Biotin (ARP61897_P050-Biotin), Rabbit, Polyclonal

Product Overview

• Article Name: FMN1 Antibody : Biotin (ARP61897_P050-Biotin), Rabbit, Polyclonal
• Biozol Catalog Number: ASB-ARP61897_P050-BIOTIN
• Supplier Catalog Number: ARP61897_P050-Biotin
• Alternative Catalog Number: ASB-ARP61897_P050-BIOTIN-100UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rabbit
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence ASEKQMVVVCKESPKEYLQPFKDKLEEFFQKAKKEHKMEESHLENAQKSF
• Conjugation: Biotin
• Alternative Names: LD, FMN

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 158 kDa
• NCBI: 342184
• UniProt: Q68DA7
• Form: Liquid. Purified antibody supplied in 1x PBS buffer.