PPIL4 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02429
Artikelname: PPIL4 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02429
Hersteller Artikelnummer: OPCA02429
Alternativnummer: ASB-OPCA02429-100UG,ASB-OPCA02429-1MG,ASB-OPCA02429-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: cyclophilin-like protein PPIL4,cyclophilin-type peptidyl-prolyl cis-trans isomerase,HDCME13P,peptidyl-prolyl cis-trans isomerase-like 4,peptidylprolyl isomerase (cyclophilin)-like 4,PPIase,rotamase PPIL4,serologically defined breast cancer antigen NY-BR-18.
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
Molekulargewicht: 73.2 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 85313
UniProt: Q8WUA2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDED