PPIL4 Recombinant Protein, Human

Catalog Number: ASB-OPCA02429
Article Name: PPIL4 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02429
Supplier Catalog Number: OPCA02429
Alternative Catalog Number: ASB-OPCA02429-100UG,ASB-OPCA02429-1MG,ASB-OPCA02429-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: cyclophilin-like protein PPIL4,cyclophilin-type peptidyl-prolyl cis-trans isomerase,HDCME13P,peptidyl-prolyl cis-trans isomerase-like 4,peptidylprolyl isomerase (cyclophilin)-like 4,PPIase,rotamase PPIL4,serologically defined breast cancer antigen NY-BR-18.
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
Molecular Weight: 73.2 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 85313
UniProt: Q8WUA2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPENVLFVCKLNPVTTDED