PSMF1 Recombinant Protein, Human

Artikelnummer: ASB-OPCA02430
Artikelname: PSMF1 Recombinant Protein, Human
Artikelnummer: ASB-OPCA02430
Hersteller Artikelnummer: OPCA02430
Alternativnummer: ASB-OPCA02430-100UG,ASB-OPCA02430-1MG,ASB-OPCA02430-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: PI31,proteasome (prosome, macropain) inhibitor subunit 1 (PI31),proteasome inhibitor PI31 subunit.
Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28.
Molekulargewicht: 45.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 9491
UniProt: Q92530
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPG