PSMF1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02430
Article Name: PSMF1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02430
Supplier Catalog Number: OPCA02430
Alternative Catalog Number: ASB-OPCA02430-100UG,ASB-OPCA02430-1MG,ASB-OPCA02430-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: PI31,proteasome (prosome, macropain) inhibitor subunit 1 (PI31),proteasome inhibitor PI31 subunit.
Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28.
Molecular Weight: 45.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 9491
UniProt: Q92530
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPG