SARAF Recombinant Protein, Human

Artikelnummer: ASB-OPCA02431
Artikelname: SARAF Recombinant Protein, Human
Artikelnummer: ASB-OPCA02431
Hersteller Artikelnummer: OPCA02431
Alternativnummer: ASB-OPCA02431-100UG,ASB-OPCA02431-1MG,ASB-OPCA02431-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: FOAP-7,HBV XAg-transactivated protein 3,HBV X-transactivated gene 3 protein,HSPC035,Protein FOAP-7,SOCE-associated regulatory factor,store-operated calcium entry-associated regulatory factor,testicular secretory protein Li 59,TMEM66,transmembrane protein 66,XTP3.
Negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca(2+) levels, and thus preventing the overload of the cell with excessive Ca(2+) ions.
Molekulargewicht: 31.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 51669
UniProt: Q96BY9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR