SARAF Recombinant Protein, Human

Catalog Number: ASB-OPCA02431
Article Name: SARAF Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02431
Supplier Catalog Number: OPCA02431
Alternative Catalog Number: ASB-OPCA02431-100UG,ASB-OPCA02431-1MG,ASB-OPCA02431-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: FOAP-7,HBV XAg-transactivated protein 3,HBV X-transactivated gene 3 protein,HSPC035,Protein FOAP-7,SOCE-associated regulatory factor,store-operated calcium entry-associated regulatory factor,testicular secretory protein Li 59,TMEM66,transmembrane protein 66,XTP3.
Negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca(2+) levels, and thus preventing the overload of the cell with excessive Ca(2+) ions.
Molecular Weight: 31.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 51669
UniProt: Q96BY9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR