IL12RB2 Recombinant Protein, Human

Produktübersicht

• Artikelname: IL12RB2 Recombinant Protein, Human
• Artikelnummer: ASB-OPCA03061
• Hersteller Artikelnummer: OPCA03061
• Alternativnummer: ASB-OPCA03061-100UG, ASB-OPCA03061-20UG
• Hersteller: Aviva
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: IL-12 receptor subunit beta-2,IL-12R subunit beta-2,interleukin 12 receptor, beta 2,interleukin-12 receptor beta-2 chain,interleukin-12 receptor subunit beta-2.

Produktbeschreibung

Receptor for interleukin-12. This subunit is the signaling component coupling to the JAK2/STAT4 pathway. Promotes the proliferation of T-cells as well as NK cells. Induces the promotion of T-cells towards the Th1 phenotype by strongly enhancing IFN-gamma production.

Produkteigenschaften

• Molekulargewicht: 69.7 kDa
• Tag: N-terminal 6xHis-tagged
• NCBI: 3595
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGR