IL12RB2 Recombinant Protein, Human

Catalog Number: ASB-OPCA03061
Article Name: IL12RB2 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA03061
Supplier Catalog Number: OPCA03061
Alternative Catalog Number: ASB-OPCA03061-100UG, ASB-OPCA03061-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: IL-12 receptor subunit beta-2,IL-12R subunit beta-2,interleukin 12 receptor, beta 2,interleukin-12 receptor beta-2 chain,interleukin-12 receptor subunit beta-2.
Receptor for interleukin-12. This subunit is the signaling component coupling to the JAK2/STAT4 pathway. Promotes the proliferation of T-cells as well as NK cells. Induces the promotion of T-cells towards the Th1 phenotype by strongly enhancing IFN-gamma production.
Molecular Weight: 69.7 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 3595
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGR