MTR Recombinant Protein, Human

Artikelnummer: ASB-OPCA03062
Artikelname: MTR Recombinant Protein, Human
Artikelnummer: ASB-OPCA03062
Hersteller Artikelnummer: OPCA03062
Alternativnummer: ASB-OPCA03062-100UG, ASB-OPCA03062-1MG, ASB-OPCA03062-20UG
Hersteller: Aviva
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: 5-methyltetrahydrofolate--homocysteine methyltransferase,5-methyltetrahydrofolate-homocysteine methyltransferase 1,cblG,cobalamin-dependent methionine synthase,HMAG,methionine synthase,MS,vitamin-B12 dependent methionine synthase.
Catalyzes the transfer of a methyl group from methyl-cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate (By similarity).
Molekulargewicht: 41 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 4548
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGY