MTR Recombinant Protein, Human

Catalog Number: ASB-OPCA03062
Article Name: MTR Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA03062
Supplier Catalog Number: OPCA03062
Alternative Catalog Number: ASB-OPCA03062-100UG, ASB-OPCA03062-1MG, ASB-OPCA03062-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: 5-methyltetrahydrofolate--homocysteine methyltransferase,5-methyltetrahydrofolate-homocysteine methyltransferase 1,cblG,cobalamin-dependent methionine synthase,HMAG,methionine synthase,MS,vitamin-B12 dependent methionine synthase.
Catalyzes the transfer of a methyl group from methyl-cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate (By similarity).
Molecular Weight: 41 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 4548
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGY