Mlkl Recombinant Protein

Artikelnummer: ASB-OPCA03064
Artikelname: Mlkl Recombinant Protein
Artikelnummer: ASB-OPCA03064
Hersteller Artikelnummer: OPCA03064
Alternativnummer: ASB-OPCA03064-100UG, ASB-OPCA03064-20UG
Hersteller: Aviva
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Alternative Synonym: 9130019I15Rik,mixed lineage kinase domain-like protein.
Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process. Activated following phosphorylation by RIPK3, leading to homotrimerization, localization to the plasma membrane and execution of programmed necrosis characterized by calcium influx and plasma membrane damage. Does not have protein kinase activity.
Konzentration: 0.1-5 mg/mL, by the Bradford Method
Molekulargewicht: 56.3 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 74568
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIF