Mlkl Recombinant Protein

Catalog Number: ASB-OPCA03064
Article Name: Mlkl Recombinant Protein
Biozol Catalog Number: ASB-OPCA03064
Supplier Catalog Number: OPCA03064
Alternative Catalog Number: ASB-OPCA03064-100UG, ASB-OPCA03064-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Mouse
Alternative Names: 9130019I15Rik,mixed lineage kinase domain-like protein.
Pseudokinase that plays a key role in TNF-induced necroptosis, a programmed cell death process. Activated following phosphorylation by RIPK3, leading to homotrimerization, localization to the plasma membrane and execution of programmed necrosis characterized by calcium influx and plasma membrane damage. Does not have protein kinase activity.
Concentration: 0.1-5 mg/mL, by the Bradford Method
Molecular Weight: 56.3 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 74568
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIF