KIAA1377 Recombinant Protein, Human

Produktübersicht

• Artikelname: KIAA1377 Recombinant Protein, Human
• Artikelnummer: ASB-OPCA03069
• Hersteller Artikelnummer: OPCA03069
• Alternativnummer: ASB-OPCA03069-100UG, ASB-OPCA03069-20UG
• Hersteller: Aviva
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: centrosomal protein 126kDa,centrosomal protein of 126 kDa,KIAA1377.

Produktbeschreibung

Participates in cytokinesis (PubMed:19799413). Necessary for microtubules and mitotic spindle organization (PubMed:24867236). Involved in primary cilium formation (PubMed:24867236).

Produkteigenschaften

• Molekulargewicht: 28.9 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• NCBI: 57562
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG