KIAA1377 Recombinant Protein, Human

Product Overview

• Article Name: KIAA1377 Recombinant Protein, Human
• Biozol Catalog Number: ASB-OPCA03069
• Supplier Catalog Number: OPCA03069
• Alternative Catalog Number: ASB-OPCA03069-100UG, ASB-OPCA03069-20UG
• Manufacturer: Aviva
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: centrosomal protein 126kDa,centrosomal protein of 126 kDa,KIAA1377.

Product Description

Participates in cytokinesis (PubMed:19799413). Necessary for microtubules and mitotic spindle organization (PubMed:24867236). Involved in primary cilium formation (PubMed:24867236).

Product Properties

• Molecular Weight: 28.9 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• NCBI: 57562
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG